SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114086 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114086
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.29e-45
Family Alanine racemase-like, N-terminal domain 0.000000507
Further Details:      
 
Domain Number 2 Region: 154-300
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.93e-29
Family Eukaryotic ODC-like 0.0000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114086   Gene: ENSMUSG00000028789   Transcript: ENSMUST00000119354
Sequence length 323
Comment pep:putative chromosome:GRCm38:4:128930233:128962420:-1 gene:ENSMUSG00000028789 transcript:ENSMUST00000119354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVQHIGVPASKIICANPCKQVAQIKYAAKHGVRLLSFDNEVELAKVVKSHPSAKMVLC
IATQDSHSLNHLSLRFGASLKSCRHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIAD
ARLVFQMGEELGHTMNILDLGGGFPGLEGAKVRFEEMASVINSALDLYFPEGCGVDILAE
LGRYYVTSAFTVAVSIVAKREVLDQASREEQTGAAPKSIVYYLDEGVYGVFNSVLFDNTC
PTPALQKKPSADQPLYSSSLWGPAVEGCDCVAEGLWLPQLQVGDWLVFDNMGAYTVDTKS
LLGGTQARRVTYAMSRLACSWKY
Download sequence
Identical sequences A8Y5E7
NP_001288770.1.92730 ENSMUSP00000114086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]