SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114224 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114224
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily PR-1-like 4.97e-45
Family PR-1-like 0.00000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114224   Gene: ENSMUSG00000023930   Transcript: ENSMUST00000144243
Sequence length 171
Comment pep:known chromosome:GRCm38:17:40783238:40794146:-1 gene:ENSMUSG00000023930 transcript:ENSMUST00000144243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWFQVMLFVFALLLRSPLTEGKDPDFTSLLTNQLQVQREIVNKHNELRRSVNPTGSDIL
KMEWSIQATTNAQKWANKCILEHSSKDDRKINIRCGENLYMSTDPTLWSTVIQSWYNENE
DFVYGVGAKPNSAVGHYTQLVWYSSFKIGCGIAYCPNQDNLKYFYVCHYCP
Download sequence
Identical sequences D3YVR2
ENSMUSP00000114224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]