SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114377 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114377
Domain Number 1 Region: 110-199
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.65e-22
Family Glutamine synthetase catalytic domain 0.025
Further Details:      
 
Domain Number 2 Region: 21-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 3.53e-21
Family Glutamine synthetase, N-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114377   Gene: ENSMUSG00000026473   Transcript: ENSMUST00000139476
Sequence length 199
Comment pep:known chromosome:GRCm38:1:153900606:153907140:1 gene:ENSMUSG00000026473 transcript:ENSMUST00000139476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEW
NFDGSSTFQSEGSNSDMYLHPVAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHICKRI
MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY
RACLYAGVKITGTNAEVMP
Download sequence
Identical sequences ENSMUSP00000114377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]