SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114590 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114590
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000687
Family Methyl-CpG-binding domain, MBD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114590   Gene: ENSMUSG00000025409   Transcript: ENSMUST00000156208
Sequence length 130
Comment pep:known chromosome:GRCm38:10:127286568:127288853:-1 gene:ENSMUSG00000025409 transcript:ENSMUST00000156208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGDNASSAADRAGGPAATPVPIPIGWQRCVREGAVYYISPSGTELSSLEQTRSYLLSDG
TCKCGLECPLNVPKVFNFDPLAPVTPGGAGVGPASEEDMTKLCNHRRKAVAMATLYRSME
TTCSHSSPGE
Download sequence
Identical sequences D3YV97
ENSMUSP00000114590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]