SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114806 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000114806
Domain Number - Region: 166-198
Classification Level Classification E-value
Superfamily POZ domain 0.000497
Family Tetramerization domain of potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114806   Gene: ENSMUSG00000038187   Transcript: ENSMUST00000135510
Sequence length 202
Comment pep:known chromosome:GRCm38:7:113315646:113351938:-1 gene:ENSMUSG00000038187 transcript:ENSMUST00000135510 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAGRPHPYDSNSSDPENWDRKLHSRPRKLYKHSSSASRVAKGGVDHTKMSLHGASGGHER
SRDRRRSSDRSRDSSHERAESQLTPCIRNVTSPTRQHHIEREKDHSSSRPSSPRPQRASP
NGSMSSAGNSSRNSSQSSSDGSCKTSGEMVFVYENAKEGARNVRTSERVTLIVDNTRFVV
DPSIFTAQPNTMLGRMFGSGLL
Download sequence
Identical sequences D6RDQ7
ENSMUSP00000114806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]