SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115341 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115341
Domain Number 1 Region: 46-141
Classification Level Classification E-value
Superfamily Hsp33 domain 0.0000471
Family Hsp33 domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115341   Gene: ENSMUSG00000030877   Transcript: ENSMUST00000149535
Sequence length 143
Comment pep:novel chromosome:GRCm38:7:120982525:120991468:1 gene:ENSMUSG00000030877 transcript:ENSMUST00000149535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLSIKSEVWVYSLITLGTEMLSSFFSFYYVKLFLEVYKISKSAFCQAQVILMIWNILT
DLSGYFHMSSQYDCCLSYRCSLLGALLHAVAFLLPWFPWKHYRESDWLIGLQLVASLCAF
DSTHAWVQQAQWRLFAETSPRQE
Download sequence
Identical sequences D3Z0S3
ENSMUSP00000115341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]