SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115590 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000115590
Domain Number - Region: 129-204
Classification Level Classification E-value
Superfamily Preprotein translocase SecY subunit 0.0366
Family Preprotein translocase SecY subunit 0.044
Further Details:      
 
Domain Number - Region: 19-104
Classification Level Classification E-value
Superfamily ARM repeat 0.0432
Family B56-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115590   Gene: ENSMUSG00000030990   Transcript: ENSMUST00000138479
Sequence length 210
Comment pep:novel chromosome:GRCm38:7:102223045:102237226:1 gene:ENSMUSG00000030990 transcript:ENSMUST00000138479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQVPLTLDRDGTLVRLRFTMVALITVCCPLVAFFFCILWSLLFHFKETTSTHCGVPNYL
PSVSSAIGGEVPQRYVWRFCIGLHSAPRFLTAFAYWNHYLSCASPCPGYRLLCRINFSLN
VVENLALLVLTYVSSSEDFTIHENAFIVFIAASLGYMLLTCILWRLTKKHTVSQEDRKSY
SWKQRLFVINFISFFSALAVYFRHNMYCEA
Download sequence
Identical sequences D3YYE3
ENSMUSP00000115590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]