SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115864 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000115864
Domain Number - Region: 340-393
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0012
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115864   Gene: ENSMUSG00000020859   Transcript: ENSMUST00000156019
Sequence length 775
Comment pep:known chromosome:GRCm38:11:94043570:94097880:1 gene:ENSMUSG00000020859 transcript:ENSMUST00000156019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XMIHNYMEHLERTKLHQLSGSDQLEATAHSRIRKERPISLGIFPLPAGDGLLTPDTQKGG
ETPGSEQWKFQELSQPRSHTSLKVSHSPEPLKAVEQEDELSDISQGGSKATTPASTANSD
VSAIPPDTPSKEDNEGFVKGTDTSNKSEISKHIEVQVAQETRNVSTESGENEEKSEVQAI
IESTPELDMDKDLSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLL
GMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLED
KNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLME
LQEAVRWTEMIRASRENPAMQEKKRSSIWQFFSRLFSSSSNATKKPEPPVNLKYNAPTSH
VTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKEDGRVQ
AFGWSLPQKYKQVANGQGETKMKNLPVPVYLRPLDEKDASMKLWCAVGVNLSGGKTRDGG
SVVGASVFYKDIAGLDTEGSKQRSASQSSLDKLDQELKEQQKEFKNQEELSSQVWICTST
HSTTKVIIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDYPAGEELSESGQVDKASLC
GSMTSNSSAEMDSLLGGITVVGCSTEGLTGAATSPSTNGASPVIEKPPEMETENSEVDEN
IPTAEEATEATEGNAGSTEDTVDISQPGVYTEHVFTDPLGVQIPEDLSPVFQSRY
Download sequence
Identical sequences F6SH61
ENSMUSP00000115864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]