SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115932 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115932
Domain Number 1 Region: 31-92
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.33e-16
Family Eukaryotic type heme oxygenase 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115932   Gene: ENSMUSG00000004070   Transcript: ENSMUST00000140367
Sequence length 93
Comment pep:known chromosome:GRCm38:16:4756845:4764684:1 gene:ENSMUSG00000004070 transcript:ENSMUST00000140367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEVETSEGVDESEKNSMAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGN
IKKELFKLATTALYFTYSALEEEMDRNKDHPAF
Download sequence
Identical sequences D3YXN4
ENSMUSP00000115932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]