SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116051 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116051
Domain Number 1 Region: 91-262,309-380
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.28e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 532-761
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.29e-32
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116051   Gene: ENSMUSG00000031142   Transcript: ENSMUST00000133637
Sequence length 844
Comment pep:putative chromosome:GRCm38:X:7607120:7619133:1 gene:ENSMUSG00000031142 transcript:ENSMUST00000133637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESEVGKDTTPEPSPANGTGPGPEWGLCPGPPTVGTDTSGASGLGTPRRRTQHNKHKTV
AVASAQRSPRALFCLTLTNPIRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPSPCASSGSGRSCTLNHTECR
GRWPGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQMEEDLRGYLDWITQAEELDLHDPS
VDGNLASLAEEGRAGHRPQLSELTNRRRGRLRWFSHSTRSTHSTSSHASLPASDTGSMTD
TPGDEDEEEGTMASCTRCLNKIMKTRICRHFRRANRGLRARCRRAVKSNACYWAVLLLVF
LNTLTIASEHHGQPLWLTQTQEYANKVLLCLFTVEMLLKLYGLGPSVYVASFFNRFDCFV
VCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLL
LLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDG
IMAYGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKDKGREKSSEG
NPPKENKVLDLNWFPDPCQVDHNYLQLQVQEIQCLWPPDLKSHLHSHTHTHTWILVIENN
KAKS
Download sequence
Identical sequences Q8C8Q4
ENSMUSP00000116051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]