SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116152 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116152
Domain Number 1 Region: 8-133
Classification Level Classification E-value
Superfamily HAD-like 1.16e-21
Family NagD-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116152   Gene: ENSMUSG00000025421   Transcript: ENSMUST00000147332
Sequence length 146
Comment pep:known chromosome:GRCm38:18:76944126:76962053:1 gene:ENSMUSG00000025421 transcript:ENSMUST00000147332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRALKAVLVDLNGTLHIEDAAVPGAQEALKRLRATSVMVRFVTNTTKESKKDLLERL
KKLEFEISEDEIFTSLTAARNLIEQKQVRPMLLVDDRALPEFTGVQTQDPNAVVIGLAPE
HFHYQLLNQAFRRKQRGQEEENSDSH
Download sequence
Identical sequences NP_001034291.1.92730 ENSMUSP00000095128 ENSMUSP00000116152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]