SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116381 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116381
Domain Number 1 Region: 417-531,653-799
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.78e-65
Family Phosphate binding protein-like 0.00000000162
Further Details:      
 
Domain Number 2 Region: 23-402
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-54
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 555-650
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000667
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116381   Gene: ENSMUSG00000001986   Transcript: ENSMUST00000139965
Sequence length 818
Comment pep:known chromosome:GRCm38:X:41401436:41678598:1 gene:ENSMUSG00000001986 transcript:ENSMUST00000139965 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTE
KPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFVT
PSFPTDADVQFVIQMRPALKGAILSLLGYYKWEKFVYLYDTERGFSILQAIMEAAVQNNW
QVTARSVGNIKDIQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYM
LANLGFTDIVLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKYT
SALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGM
TGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSSSSENRTIV
VTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPE
TKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFS
FLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIF
NSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIE
SAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVR
KSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLN
EQGLLDKLKNKWWYDKGECGSGGGDSKNACKPCSIETQ
Download sequence
Identical sequences F2Z488
ENSMUSP00000116381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]