SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116627 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116627
Domain Number 1 Region: 47-460
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 3.4e-100
Family Iron-containing alcohol dehydrogenase 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116627   Gene: ENSMUSG00000025911   Transcript: ENSMUST00000144177
Sequence length 465
Comment pep:known chromosome:GRCm38:1:9547948:9577970:1 gene:ENSMUSG00000025911 transcript:ENSMUST00000144177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARARVTHLLRHLQSTACQCPTHSHTYSQAPGPSGKTADYAFEMAVSNIRYGAGVTK
EVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDDVRVEPTDGSFMDA
IEFAKKGAFDAYVAVGGGSTMDTCKAANLYASSPHSEFLDYVNAPIGKGKPVTVPLKPLI
AVPTTSGTGSETTGVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPCQVVANSGFD
VLCHALESYTAIPYSMRSPCPSNPIQRPAYQGSNPISDIWAVHALQIVAKYLKRAVRNPD
DLEARSKMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKEYNVDHPLVPHGLSVV
LTSPAVFTFTAQMFPERHLETAGILGANIRTARIQDAGLVLADALRKFLFDLNVDDGLAA
LGYSKDDIPSLVKGTLPQERVTKLAPRAQSEEDLSALFEASMKLY
Download sequence
Identical sequences Q8R0N6
NP_780445.1.92730 ENSMUSP00000116627 ENSMUSP00000116627 ENSMUSP00000116627 10090.ENSMUSP00000116627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]