SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116688 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000116688
Domain Number - Region: 104-124
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0105
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116688   Gene: ENSMUSG00000015522   Transcript: ENSMUST00000136413
Sequence length 126
Comment pep:known chromosome:GRCm38:3:95476097:95487311:1 gene:ENSMUSG00000015522 transcript:ENSMUST00000136413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTGTVKKEGQQSSMRMCMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRCRNGLGSVKEG
EPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQELLGKNIVEFCHPED
QQLLRD
Download sequence
Identical sequences F7C9F6
ENSMUSP00000116688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]