SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116962 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116962
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 4.19e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000867
Further Details:      
 
Domain Number 2 Region: 52-82
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.00000000000249
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116962   Gene: ENSMUSG00000033543   Transcript: ENSMUST00000140305
Sequence length 87
Comment pep:known chromosome:GRCm38:9:70012574:70019474:1 gene:ENSMUSG00000033543 transcript:ENSMUST00000140305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTEL
Download sequence
Identical sequences D3Z7S8
ENSMUSP00000116962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]