SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117112 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000117112
Domain Number - Region: 9-41
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 0.0942
Family 4'-Phosphopantetheinyl transferase SFP 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117112   Gene: ENSMUSG00000062995   Transcript: ENSMUST00000151758
Sequence length 45
Comment pep:known chromosome:GRCm38:6:8754634:8778123:-1 gene:ENSMUSG00000062995 transcript:ENSMUST00000151758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGHKCYSWELQDRFAQDKSVVNKMQQKYWETKQAFIKATGKKED
Download sequence
Identical sequences D3Z699
ENSMUSP00000117112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]