SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117201 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117201
Domain Number 1 Region: 46-201
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-51
Family Inorganic pyrophosphatase 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117201   Gene: ENSMUSG00000028013   Transcript: ENSMUST00000125858
Sequence length 204
Comment pep:putative chromosome:GRCm38:3:133339109:133378082:1 gene:ENSMUSG00000028013 transcript:ENSMUST00000125858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDADAPQNCQSWEGKDKQIPGPHRPNSQACLVKFQAIETLSQMKVLSRGDVVHVKILGT
LALIDQSETDWKIIAINVNDPEAEKFHDIDDVKKFKPGYLEATLNWFRLYKVPDGKPENK
FAFNGEFKNKAFALDVINSAHERWKEMVMKKCDKGAISCVNVHICDSPFHCTMEEARSLV
ESVPTPSMNKESNVEEEVWHFLRN
Download sequence
Identical sequences ENSMUSP00000117201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]