SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117372 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000117372
Domain Number - Region: 6-95
Classification Level Classification E-value
Superfamily E set domains 0.000105
Family Arrestin/Vps26-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117372   Gene: ENSMUSG00000026972   Transcript: ENSMUST00000142887
Sequence length 108
Comment pep:known chromosome:GRCm38:2:24926158:24935142:-1 gene:ENSMUSG00000026972 transcript:ENSMUST00000142887 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
GRVQLFEIRLSQGRVVYGPGEPLAGTVHLRLGAPLPFRAIRVTCMGSCGVSTKANDGAWV
VEESYFNSSLSLADKVCRLESTTSLFSSCFLPQHPHLLRDPLGRLYTR
Download sequence
Identical sequences F7ANZ2
ENSMUSP00000117372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]