SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117461 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117461
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.09e-33
Family Ribosomal L11/L12e N-terminal domain 0.0000064
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.31e-18
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117461   Gene: ENSMUSG00000038900   Transcript: ENSMUST00000126610
Sequence length 165
Comment pep:known chromosome:GRCm38:2:32961559:32964496:1 gene:ENSMUSG00000038900 transcript:ENSMUST00000126610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEVKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
Download sequence
Identical sequences A0A0P6DE72 P35979 Q5BLK0
ENSMUSP00000084807 ENSMUSP00000117461 ENSMUSP00000084807 ENSMUSP00000117461 ENSMUSP00000136144 NP_033102.2.92730 XP_006918045.1.64745 XP_011362563.1.92234 XP_016019204.1.101085 10090.ENSMUSP00000084807 10090.ENSMUSP00000090284 ENSMUSP00000084807 ENSMUSP00000117461 ENSPVAP00000000878 ENSPVAP00000000878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]