SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117676 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117676
Domain Number 1 Region: 116-244
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000408
Family Quinoprotein alcohol dehydrogenase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117676   Gene: ENSMUSG00000015095   Transcript: ENSMUST00000124375
Sequence length 246
Comment pep:known chromosome:GRCm38:2:25503226:25504834:1 gene:ENSMUSG00000015095 transcript:ENSMUST00000124375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDITSCSVLWLNNAFQDVESENVNVVKRLFKIQNLNASTIRTVMVADCSRFDSPDLLLDA
SDQAGLPCRVFDLGGDTEEEATDPGIKQILPHQMTTAGPVLGEGRGSDAFFDALDHVIDV
HGHIIGMGLSPDNRYLYVNSRAWPPGSVVADPMQPPPIAEEIDLLVFDLKTMREVKRALR
AHRAYTPNDECFFIFLDVSRDFVASGAEDRHGYIWDRHYNICLAKLRHEDVVNSVAFSPQ
EQELLL
Download sequence
Identical sequences A0A0A0MQH6
ENSMUSP00000117676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]