SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117815 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117815
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 6.12e-87
Family Integrin A (or I) domain 0.0000000446
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 2.56e-24
Family Integrin domains 0.00025
Further Details:      
 
Domain Number 3 Region: 622-704
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-18
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000942
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 580-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Integrin beta EGF-like domains 0.0024
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number 7 Region: 80-155
Classification Level Classification E-value
Superfamily Integrin domains 0.00000382
Family Integrin domains 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000117815
Domain Number - Region: 501-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117815   Gene: ENSMUSG00000026971   Transcript: ENSMUST00000154764
Sequence length 755
Comment pep:known chromosome:GRCm38:2:60605139:60673726:-1 gene:ENSMUSG00000026971 transcript:ENSMUST00000154764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELVCLFLLLLGRNDHVQGGCAWGGAESCSDCLLTGPHCAWCSQENFTHLSGAGERCD
TPANLLAKGCQLPFIENPVSRIEVLQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGREQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEITNPCSSIPYFCLPTFGFKHILPLTDDAERFNEIVRKQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDHRNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTALCNNGVLFPHQKKCSHMKVGDTASFNVT
VSVSNCEKRSRNLIIKPVGLGDTLEILVSAECDCDCQREIETNSSKCHNGNGSFQCGVCT
CNPGHMGPHCECGEDMVSTDSCKESPGHPSCSGRGDCYCGQCICHLSPYGSIYGPYCQCD
NFSCLRHKGLLCGDNGDCDCGECVCRDGWTGEYCNCTTNRDSCTSEDGVLCSGRGDCVCG
KCVCRNPGASGPTCERCPTCGDPCNSKRSCIECYLSADGQAQEECADKCKAIGATISEED
FSKDTSVSCSLQGENECLITFLITTDNEGKTIIHNINEKDCPKPPNIPMIMLGVSLAILL
IGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQT
Download sequence
Identical sequences B1AYG7
ENSMUSP00000117815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]