SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118460 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000118460
Domain Number - Region: 3-32
Classification Level Classification E-value
Superfamily UBA-like 0.000207
Family UBA domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118460   Gene: ENSMUSG00000027708   Transcript: ENSMUST00000154069
Sequence length 115
Comment pep:putative chromosome:GRCm38:3:35918998:35930119:-1 gene:ENSMUSG00000027708 transcript:ENSMUST00000154069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYTRYKDP
QDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELG
Download sequence
Identical sequences A0A1B0GXL7
ENSMUSP00000118460 ENSMUSP00000121530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]