SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118702 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118702
Domain Number 1 Region: 3-88
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 7.5e-21
Family Extradiol dioxygenases 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118702   Gene: ENSMUSG00000029445   Transcript: ENSMUST00000144679
Sequence length 96
Comment pep:putative chromosome:GRCm38:5:123172101:123175915:-1 gene:ENSMUSG00000029445 transcript:ENSMUST00000144679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKTEDIITAIRHLRERGTEFLAAPSSYYKLLRENLKSAKIQVKESMDVLEELHILVDYDE
KGYLLQIFTKPMQDRPTLFLEVIQRHNHQVRLAPRG
Download sequence
Identical sequences F6X9Z6
ENSMUSP00000118702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]