SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118725 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118725
Domain Number 1 Region: 59-160
Classification Level Classification E-value
Superfamily FKBP-like 7.66e-32
Family FKBP immunophilin/proline isomerase 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118725   Gene: ENSMUSG00000032966   Transcript: ENSMUST00000142271
Sequence length 161
Comment pep:putative chromosome:GRCm38:2:151543899:151561690:1 gene:ENSMUSG00000032966 transcript:ENSMUST00000142271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNQGRIPILREMTYREGKTRQPAHILLSVPPYFYDFLSREAGRRWQKLRTRTFKKLPMEG
ILKYILARTDSSHGPNRSSCCGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQM
SVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVELLKLE
Download sequence
Identical sequences F6X9I3
ENSMUSP00000118725 ENSMUSP00000118725 ENSMUSP00000118725 10090.ENSMUSP00000118725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]