SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118842 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118842
Domain Number 1 Region: 73-147
Classification Level Classification E-value
Superfamily DNA-binding domain 1.18e-23
Family Methyl-CpG-binding domain, MBD 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118842   Gene: ENSMUSG00000031393   Transcript: ENSMUST00000123362
Sequence length 172
Comment pep:putative chromosome:GRCm38:X:74035289:74085609:-1 gene:ENSMUSG00000031393 transcript:ENSMUST00000123362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAG
KAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY
DVYLINPQGKAFRSKVELIAYFEKLQELAGVGDAPKGAALGDQRQQHQKVFR
Download sequence
Identical sequences D3YY81
ENSMUSP00000118842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]