SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118906 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118906
Domain Number 1 Region: 24-254
Classification Level Classification E-value
Superfamily CutC-like 4.05e-78
Family CutC-like 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118906   Gene: ENSMUSG00000025193   Transcript: ENSMUST00000153295
Sequence length 254
Comment pep:novel chromosome:GRCm38:19:43753137:43768238:1 gene:ENSMUSG00000025193 transcript:ENSMUST00000153295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKGASCERKQAWISSGKAGNGFLMEVCVDSVESAVNAERGGAGRIELCSGLLEGGTTPS
MGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLYGADGLVFGALTEDG
HIDKELCLSLVALCRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALEGLP
LIKQLIDQAKGRIVVMPGGGITDKNLQRILEGSGATEFHCSARSSRDSGMKFRNSSVAMG
ASLAHSEYSLKVTD
Download sequence
Identical sequences D3YY50
ENSMUSP00000118906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]