SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119001 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000119001
Domain Number - Region: 162-201
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00141
Family WD40-repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119001   Gene: ENSMUSG00000022214   Transcript: ENSMUST00000150481
Sequence length 203
Comment pep:known chromosome:GRCm38:14:55560533:55564403:1 gene:ENSMUSG00000022214 transcript:ENSMUST00000150481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRNSSSAGSGSLEPSEGLSRRGTGLRRSEEEEEEDEDVDLAQVLAYLLRRGQVRLVQG
RGAANLQLIQALSDSEEEHDSAWDGRLGDRYNPPVDATPDTRELEYNEIKTQVGLATGRL
GLRRTALQQSFPQMLHQRERGLCHRGSFSLGEQSRVMSHFLPNDLSFTDTYSQKAFCGIY
SKDGQIFMSACQDQTIRLYDCRY
Download sequence
Identical sequences D3Z2V1
ENSMUSP00000119001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]