SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119292 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119292
Domain Number 1 Region: 39-120
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000734
Family Endostatin 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119292   Gene: ENSMUSG00000028339   Transcript: ENSMUST00000140413
Sequence length 121
Comment pep:putative chromosome:GRCm38:4:47288057:47293222:1 gene:ENSMUSG00000028339 transcript:ENSMUST00000140413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHIAPRTKKEAPETWSSTLGSRELSVLGQVWKHGEKGEPGAILTGDVPLEMMKGRKGEP
GIHGAPGPMGPKGPPGHKGEFGLPGRPGRPGLNGLKGAKGDRGVTLPGPPGLPGPPGPPG
P
Download sequence
Identical sequences A2AJY4
ENSMUSP00000119292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]