SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119699 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119699
Domain Number 1 Region: 2-37
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000889
Family Integrin beta tail domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119699   Gene: ENSMUSG00000025809   Transcript: ENSMUST00000149116
Sequence length 112
Comment pep:putative chromosome:GRCm38:8:128724333:128732389:1 gene:ENSMUSG00000025809 transcript:ENSMUST00000149116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCKEKDIDDCWFYFTYSVNGNNEAIVHVVETPDCPTGPDIIPIVAGVVAGIVLIGLALLL
IWKLLMIIHDRREFAKFEKEKMNAKWDTQENPIYKSPINNFKNPNYGRKAGL
Download sequence
Identical sequences A0A0A0MQJ3
ENSMUSP00000119699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]