SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119850 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119850
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.00000000000000388
Family Actin/HSP70 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119850   Gene: ENSMUSG00000051396   Transcript: ENSMUST00000124331
Sequence length 74
Comment pep:known chromosome:GRCm38:2:3504527:3512757:-1 gene:ENSMUSG00000051396 transcript:ENSMUST00000124331 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAIGVHLGCTSACVAVYKDGRADVVANDAGDRVTPAIVAYSEREQVVGLAAKQSRIRHV
SSTVVKVKQILGRR
Download sequence
Identical sequences ENSMUSP00000119850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]