SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119930 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119930
Domain Number 1 Region: 20-138
Classification Level Classification E-value
Superfamily FKBP-like 9.82e-43
Family FKBP immunophilin/proline isomerase 0.000001
Further Details:      
 
Domain Number 2 Region: 132-247
Classification Level Classification E-value
Superfamily FKBP-like 1.41e-28
Family FKBP immunophilin/proline isomerase 0.00000239
Further Details:      
 
Domain Number 3 Region: 248-291
Classification Level Classification E-value
Superfamily TPR-like 0.0000683
Family Tetratricopeptide repeat (TPR) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119930   Gene: ENSMUSG00000030357   Transcript: ENSMUST00000150387
Sequence length 298
Comment pep:novel chromosome:GRCm38:6:128433215:128438140:-1 gene:ENSMUSG00000030357 transcript:ENSMUST00000150387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRAEGLRPRLPGTPRPQRAPSTWTKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSS
LDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGAAGSPPKIPPNATLVF
EVELFEFKGEDLTEEEDGGIIRRIRTRGEGYARPNDGAMVEVALEGYHKDRLFDQRELCF
EVGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKERFQIPPHAELRYEVRLK
SFEKAKESWEMSSAEKLEQSNIVKERGTAYFKEGKYKQALLQYKKIVSWLEYESSFSG
Download sequence
Identical sequences ENSMUSP00000119930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]