SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119947 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119947
Domain Number 1 Region: 90-164
Classification Level Classification E-value
Superfamily DNA-binding domain 1.47e-23
Family Methyl-CpG-binding domain, MBD 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119947   Gene: ENSMUSG00000031393   Transcript: ENSMUST00000140399
Sequence length 189
Comment pep:putative chromosome:GRCm38:X:74035670:74085609:-1 gene:ENSMUSG00000031393 transcript:ENSMUST00000140399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAATAAAAAAPSGGGGGGEEERLEEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKH
EPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEG
WTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKLQELAGVGDAPKGAALGDQ
RQQHQKVFR
Download sequence
Identical sequences D3Z7U4
ENSMUSP00000119947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]