SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120136 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120136
Domain Number 1 Region: 99-220
Classification Level Classification E-value
Superfamily CalX-like 5.23e-24
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 2 Region: 352-487
Classification Level Classification E-value
Superfamily CalX-like 2.18e-22
Family CalX-beta domain 0.0069
Further Details:      
 
Domain Number 3 Region: 2-99
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000144
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 4 Region: 227-338
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000157
Family CalX-beta domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120136   Gene: ENSMUSG00000069170   Transcript: ENSMUST00000125698
Sequence length 533
Comment pep:known chromosome:GRCm38:13:81095069:81444504:-1 gene:ENSMUSG00000069170 transcript:ENSMUST00000125698 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XAEAGWDFVPASGELLFEAREKMKSLYIDILDDNLPEGPEEFVLAITRVDLQGRGYDFTI
QENGLQIDQPPEIGNISIVRIIIMKNDNAEGIIEFDPKYTDISVEEDAGVITLPVLRLHG
TYGHVSADFSSRGFSAVPGGYVLHGSSVTFQHGQNLSFINVSIIDDNGSEFEKQFEILLI
GATGGAILGRHLVSKITIAKSDSPFGIIRFLNQSKISLPNPSSTMALHLVLERTGGLLGE
IQVSWEVVGPDAEEPLPPHNGDFADPVSGTVSFGDGEGGVRSIILRVCPHEETEAEETFI
VQLKPLREAKLDPRAKAVTLTIQKFGDPNGVIHFAPESLSKRRFSEPPPSDGPLLVSFLV
TRSKGTSGDIKVHWELSSEFDITRDFLSTRGFFTIADGESDASFDVHLLPDDVPEIEEEY
AVQLVSVEGGAELDLGKCTARFSVSANDDPHGVFALYSDRQSVLIGQNLDRSIQINITRL
AGAFGAVAVRVQILSDNKEDPVATENEERQLVITDGARYKVGLVPLKNQIPFL
Download sequence
Identical sequences F6X844
ENSMUSP00000120136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]