SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120437 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000120437
Domain Number - Region: 45-96
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0753
Family Quinoprotein alcohol dehydrogenase-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120437   Gene: ENSMUSG00000040964   Transcript: ENSMUST00000143614
Sequence length 163
Comment pep:novel chromosome:GRCm38:4:140591932:140649360:-1 gene:ENSMUSG00000040964 transcript:ENSMUST00000143614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSNPPPQPAIGAPLAPSAPGPSPEVEEDSGEAFEFDDSDEEEDTSSGLVVPGLAPERD
TEPSLICFDTVPGSDLDPAAAPPQTEAPTVVSNGDAVGAAISGVRRSSWKRKSSRRIDRF
TFPALEEDVIYDDVPCESPDAHQPGAERGLVYEDVHRAGAPRE
Download sequence
Identical sequences A2AWP7
ENSMUSP00000120437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]