SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120472 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120472
Domain Number 1 Region: 19-235
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.6e-82
Family Transferrin 0.000000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120472   Gene: ENSMUSG00000032554   Transcript: ENSMUST00000126359
Sequence length 237
Comment pep:putative chromosome:GRCm38:9:103223085:103228442:-1 gene:ENSMUSG00000032554 transcript:ENSMUST00000126359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTFSQGKRRAGLCLAVPDKTVKWCAVSEHENTKCISFRDHMKTVLPPDGPRLACVKKTS
YPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFYGSVEHPQTYYYAVAVVKKG
TDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRSPLEKAVSSFFSGSCVPCADP
VAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVAFVKHTTIFEVLPEKADRD
Download sequence
Identical sequences D3YYR8
ENSMUSP00000120472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]