SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120713 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120713
Domain Number 1 Region: 80-453
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.79e-131
Family Protein prenyltransferases 0.000000000000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120713   Gene: ENSMUSG00000033373   Transcript: ENSMUST00000137826
Sequence length 471
Comment pep:putative chromosome:GRCm38:12:76765598:76920231:1 gene:ENSMUSG00000033373 transcript:ENSMUST00000137826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGDCVEKEYPNRGTTCLENGSFLLNFAGCAVCSKRDFMLITNRSLKEEDGEEIVTYDHL
CKNCHHVVARHEYTFSIMDEFQAKVEEKIQEVFSSYKFNHLVPRLILQREKHFHYLKRGL
RQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQ
YPHLAPTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYC
AASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKER
SLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMS
HWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDMV
MGVPENVLQPTHPVYNIGPEKVIQATTHFLQKPVPGFEECEDEVTSDPATD
Download sequence
Identical sequences D3YWJ4
ENSMUSP00000120713 ENSMUSP00000120713 ENSMUSP00000116906 10090.ENSMUSP00000120713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]