SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120733 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120733
Domain Number 1 Region: 64-162
Classification Level Classification E-value
Superfamily eIF4e-like 1.27e-38
Family Translation initiation factor eIF4e 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120733   Gene: ENSMUSG00000074895   Transcript: ENSMUST00000132415
Sequence length 162
Comment pep:putative chromosome:GRCm38:13:54784001:54786863:1 gene:ENSMUSG00000074895 transcript:ENSMUST00000132415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSEVVSLPHPPFPEQLSSWGEKSGHQRVSLCNPGCPGSHSLDPAGLELKRSACLCLLS
AGIKGGWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFKE
GILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLV
Download sequence
Identical sequences Q27ZI8
ENSMUSP00000120733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]