SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121170 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121170
Domain Number 1 Region: 46-116
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.31e-16
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 132-186
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000112
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121170   Gene: ENSMUSG00000040187   Transcript: ENSMUST00000129788
Sequence length 199
Comment pep:known chromosome:GRCm38:6:146805530:146832646:1 gene:ENSMUSG00000040187 transcript:ENSMUST00000129788 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEFPRKRRGRDSQPLQSEFMTDTTVESLPQNPFASLLSTRTGVSAPSGIREAHSQMEKRR
RDKMNHLIQKLSSMIPPHIPTAHKLDKLSVLRRAVQYLRSLRGMTELYLGENSKPSFIQD
KELSHLILKAAEGFLFVVGCERGRIFYVSKSVSKTLRYDQASLIGQNLFDFLHPKDVAKV
KEQLSCDGSPREKPIDTKK
Download sequence
Identical sequences ENSMUSP00000121170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]