SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121252 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000121252
Domain Number - Region: 43-85
Classification Level Classification E-value
Superfamily Scorpion toxin-like 0.0436
Family Plant defensins 0.083
Further Details:      
 
Domain Number - Region: 2-27
Classification Level Classification E-value
Superfamily Kringle-like 0.0518
Family Kringle modules 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121252   Gene: ENSMUSG00000020393   Transcript: ENSMUST00000151978
Sequence length 115
Comment pep:putative chromosome:GRCm38:11:5204833:5238448:-1 gene:ENSMUSG00000020393 transcript:ENSMUST00000151978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGME
SGYACFCGNNPDYWKHGEAASTECNSVCFGDHTQPCGGDGRIILFDTFLNRQPCS
Download sequence
Identical sequences F6S1T7
ENSMUSP00000121252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]