SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121277 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121277
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000556
Family Kringle modules 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121277   Gene: ENSMUSG00000034614   Transcript: ENSMUST00000138907
Sequence length 176
Comment pep:novel chromosome:GRCm38:11:3332109:3341674:1 gene:ENSMUSG00000034614 transcript:ENSMUST00000138907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPGNHNYCRNPDQDPRGPWCYISSETGVPEKRPCEDVSCPETTSQAPPPSSAMELEEKSG
APGDKEAQVFPPANALPARSEAAEVQPVIGISQLVRMNSKEKKDLGTLGYVLGITMMVII
LAIGAGIIVGYTYKSLRTAFGRLPILGQFPDLQELDLAALNSKLSGCPVQKPGGRT
Download sequence
Identical sequences F6S185
ENSMUSP00000121277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]