SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121688 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000121688
Domain Number - Region: 21-71
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0523
Family HBL-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121688   Gene: ENSMUSG00000002102   Transcript: ENSMUST00000146506
Sequence length 203
Comment pep:known chromosome:GRCm38:2:91054301:91056996:1 gene:ENSMUSG00000002102 transcript:ENSMUST00000146506 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XKMATVWDEAEQDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIK
ENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFL
PVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQ
IQEDFFLAAGGSHCLAYEPQREV
Download sequence
Identical sequences F6Q2E3
ENSMUSP00000121688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]