SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121840 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121840
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.39e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121840   Gene: ENSMUSG00000033543   Transcript: ENSMUST00000140265
Sequence length 62
Comment pep:known chromosome:GRCm38:9:70012643:70022738:1 gene:ENSMUSG00000033543 transcript:ENSMUST00000140265 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRN
CF
Download sequence
Identical sequences D6RIQ7
ENSMUSP00000121840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]