SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121878 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121878
Domain Number 1 Region: 2-27
Classification Level Classification E-value
Superfamily Histone-fold 0.00000129
Family Archaeal histone 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121878   Gene: ENSMUSG00000073705   Transcript: ENSMUST00000150150
Sequence length 58
Comment pep:putative chromosome:GRCm38:4:149128833:149132635:-1 gene:ENSMUSG00000073705 transcript:ENSMUST00000150150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARHAKRSTVTTEDVKLLARRNNSLLKYITEKNEEIAQLNLKGKAKKKRKPEDESRS
Download sequence
Identical sequences A6PWQ1
ENSMUSP00000121878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]