SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121899 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121899
Domain Number 1 Region: 144-291
Classification Level Classification E-value
Superfamily CalX-like 9.29e-27
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 2 Region: 406-552
Classification Level Classification E-value
Superfamily CalX-like 1.48e-22
Family CalX-beta domain 0.0038
Further Details:      
 
Domain Number 3 Region: 263-398
Classification Level Classification E-value
Superfamily CalX-like 9.16e-19
Family CalX-beta domain 0.0045
Further Details:      
 
Domain Number 4 Region: 37-158
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000012
Family CalX-beta domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121899   Gene: ENSMUSG00000069170   Transcript: ENSMUST00000128585
Sequence length 616
Comment pep:known chromosome:GRCm38:13:81577426:81633139:-1 gene:ENSMUSG00000069170 transcript:ENSMUST00000128585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTSEPGMISSFLLVYLSTLFISFVFGEAEIRFTGQTEFFVNETSTTVIRLVIERIGEP
ANVTAIVSLSGEDTGDFFDTYAAAFIPARGTNRTVYIAVCDDDLPEPDETFTFHLTLQKP
SANVKLGWPRAASVTILSNDNAFGIISFSTPSSISVIEPRSRNASVPLTLIREKGTYGMV
TVTFDVSGGPNPPEEDLNPVRGNITFPPGRATVIYNVTVLDDEVPENDELFLIQLRSVEG
GAEINASRSSVEIIVKKNDSPVNFMQSVYVVPEDDHVLTIPVLRGKDSDGNLIGSDETQV
SIRYKVMTWDSTAHAQQNVDFIDLQPDTTLVFPPFVHESHLKFQIIDDLIPEIAESFHIM
LLKNTLQGDAVLMGPSTVQVTIKPNDKPYGVLSFNSILFERPVIIDEDTASSSRFEEIAV
VRNGGTHGNVSVSWVLTRNSSDPSPVTADITPASGTLQFAQGQMLAPISLVVFDDDLPEE
AEAYLLTILPHTIQGGAEVSEPAQLLFYIQDSDNVYGEIAFFPGESQKIESSPSERSLSL
SLARRGGSKGDVRVIYSALYIPAGAMDPLRAKDGILNTSRRSSLLFPEQNQQVSIKLPIR
NDAFLQNGAHFLVQVL
Download sequence
Identical sequences ENSMUSP00000121899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]