SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121925 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121925
Domain Number 1 Region: 4-136
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 9.16e-34
Family Isochorismatase-like hydrolases 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121925   Gene: ENSMUSG00000052605   Transcript: ENSMUST00000133406
Sequence length 170
Comment pep:putative chromosome:GRCm38:7:4849335:4851229:-1 gene:ENSMUSG00000052605 transcript:ENSMUST00000133406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQMLEIPVLLTEHYPQGLGPTVPELGAQGLRTMSKTSFSMVPPLQQELDKLPQLQSVLLC
GIETQGCILHTALDLLDRGLQVHVAVDACSSQSEMNRLVALARMQQSGVFLSTSEVLILQ
LVKDAAHPQFKEVRPPLSPRHRRQASRPLVIFIFTLSLSYYVFPVCMYVL
Download sequence
Identical sequences ENSMUSP00000121925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]