SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121938 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121938
Domain Number 1 Region: 10-48
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000196
Family N-terminal domain of MutM-like DNA repair proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121938   Gene: ENSMUSG00000039396   Transcript: ENSMUST00000135443
Sequence length 49
Comment pep:putative chromosome:GRCm38:8:53609508:53638678:-1 gene:ENSMUSG00000039396 transcript:ENSMUST00000135443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAKDSGWKLLRLFNGYVYSGVETLGKELFMYFGPRALRIHFGMKGSIL
Download sequence
Identical sequences D3Z1T7
ENSMUSP00000121938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]