SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122087 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122087
Domain Number 1 Region: 17-128
Classification Level Classification E-value
Superfamily FKBP-like 5.3e-42
Family FKBP immunophilin/proline isomerase 0.00000113
Further Details:      
 
Domain Number 2 Region: 122-213
Classification Level Classification E-value
Superfamily FKBP-like 4.32e-20
Family FKBP immunophilin/proline isomerase 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122087   Gene: ENSMUSG00000030357   Transcript: ENSMUST00000151796
Sequence length 214
Comment pep:novel chromosome:GRCm38:6:128433762:128437653:-1 gene:ENSMUSG00000030357 transcript:ENSMUST00000151796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNLHCMSPCIHCFSSVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFD
LGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGAAGSPPKIPPNATLVFEVELFEFKGE
DLTEEEDGGIIRRIRTRGEGYARPNDGAMVEVALEGYHKDRLFDQRELCFEVGEGESLDL
PCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKER
Download sequence
Identical sequences ENSMUSP00000122087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]