SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122407 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122407
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Kringle-like 1.38e-20
Family Kringle modules 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122407   Gene: ENSMUSG00000034614   Transcript: ENSMUST00000136536
Sequence length 257
Comment pep:novel chromosome:GRCm38:11:3330787:3341683:1 gene:ENSMUSG00000034614 transcript:ENSMUST00000136536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVHTFLLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLRCLNWLAAQGSRESLT
EPSPGNHNYCRNPDQDPRGPWCYISSETGVPEKRPCEDVSCPGTRPGTTETTSQAPPPSS
AMELEEKSGAPGDKEAQVFPPANALPARSEAAEVQPVIGISQLVRMNSKEKKDLGTLGYV
LGITMMVIILAIGAGIIVGYTYKRGKDLKEQHEKKACEREMQRITLPLSAFTNPTCETVD
ENTIIVHSNQTPADVQE
Download sequence
Identical sequences Z4YN57
ENSMUSP00000122407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]