SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122510 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122510
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.29e-36
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.0000348
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000122510
Domain Number - Region: 130-145
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0102
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122510   Gene: ENSMUSG00000001166   Transcript: ENSMUST00000130045
Sequence length 146
Comment pep:known chromosome:GRCm38:5:120805400:120812514:-1 gene:ENSMUSG00000001166 transcript:ENSMUST00000130045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLFFNNLTSFEEQLKRRGEFVEEIQKHLCQLQQEKPFKVKFEVQSSEEPNSRSLSFKLS
SPELQQEVEFDVQPAYDVLYELRNNTYAEPQFYNKVYAQLIHECTTLEKEGDFSICFTDL
HQNFMRYRAPKLWNLIRLVKHWYQLV
Download sequence
Identical sequences ENSMUSP00000122510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]