SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122699 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122699
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily Heme oxygenase-like 5.28e-16
Family Eukaryotic type heme oxygenase 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122699   Gene: ENSMUSG00000004070   Transcript: ENSMUST00000154117
Sequence length 65
Comment pep:putative chromosome:GRCm38:16:4726361:4764848:1 gene:ENSMUSG00000004070 transcript:ENSMUST00000154117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRNKDHPAFAPLYFPTELHRKAALIKDMKYFFGENWEEQVKCSEAAQKYVDRIHYVGQN
EPELL
Download sequence
Identical sequences D3Z4A2
ENSMUSP00000122699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]